PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN13812.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TCP
Protein Properties Length: 370aa    MW: 41284.4 Da    PI: 9.5783
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN13812.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP147.87.3e-46962292130
         TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec....eaesssssasnsssg.kaaksaa 95 
                 a+kkdrhskihT++g+RdRRvRls+e+a++fFdLqd+LGfdk+s+t++WL++++k+aikelt+++ s +s+     ++++ +s+ +++  + ++  + +
  KHN13812.1  96 ATKKDRHSKIHTSQGLRDRRVRLSIEIARKFFDLQDMLGFDKASNTLDWLFTKSKKAIKELTRSKHSVESFEfsssSEGEVVSTIQQQDLQqQHGINLE 194
                 89**************************************************************55555222233355555555555555524444455 PP

         TCP  96 kskksqksaasalnlakesrakarararertrekm 130
                 ++k ++  a ++ +++kesr+kararare+t++k 
  KHN13812.1 195 NGKLKEPAAYCVKAKMKESREKARARAREKTSSKV 229
                 999999999999*****************888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.2E-4297228IPR005333Transcription factor, TCP
PROSITE profilePS5136936.40198156IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.258211228IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MFPSTNYTSS GSYPRFPSSS SSTSPYPSFT LLHPENSSSS NNTFLHDPLA LTYIPSHYHA  60
PIPETLANWA VADCAILNQD LGGALYGITK KPMKKATKKD RHSKIHTSQG LRDRRVRLSI  120
EIARKFFDLQ DMLGFDKASN TLDWLFTKSK KAIKELTRSK HSVESFEFSS SSEGEVVSTI  180
QQQDLQQQHG INLENGKLKE PAAYCVKAKM KESREKARAR AREKTSSKVL CNTSGEGKVQ  240
ELKKKCPATE NPQILNQLRS TLQPPHPQNV GGEVPRDDDF NVIEESIVIR RKLKHTLMSS  300
NIHHQNAVIP KEASVNNSDY HSFPNLSPNW EANNGANGRS TFCAIASMNL STGLQIFGKS  360
WEECTNPHPS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551798.10.0PREDICTED: transcription factor CYCLOIDEA
TrEMBLA0A0B2Q2160.0A0A0B2Q216_GLYSO; Transcription factor TCP1
TrEMBLK7MV750.0K7MV75_SOYBN; Uncharacterized protein
STRINGGLYMA18G51581.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17383294
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.24e-30TCP family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]